PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538864.1_FGP043
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 680aa    MW: 75161.9 Da    PI: 8.0263
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538864.1_FGP043genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.46.4e-2464165199
                        EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                        f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW++F + ++L +gD v+F   +
  KN538864.1_FGP043  64 FCKTLTASDTSTHGGFSVPRRAAEDCfppldySLQRP-SQELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSGFINKKKLVSGDAVLFL--R 152
                        99****************************9966654.569************************************************..4 PP

                        SSEE..EEEEE-S CS
                 B3  87 rsefelvvkvfrk 99 
                         +++el+++v+r+
  KN538864.1_FGP043 153 GEDGELRLGVRRA 165
                        49999*****996 PP

2Auxin_resp108.47.7e-36190270182
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                        +aha++ ks+F+++YnPr s+seF+++++k+++++++++svGmRfk+++e+ed+serr +G+++g +++dp  W++SkW++L
  KN538864.1_FGP043 190 VAHAVAVKSIFHIYYNPRLSQSEFIIPYWKFMRSFSQPFSVGMRFKLRYESEDASERRRTGIIIGSREADP-MWHGSKWKCL 270
                        799********************************************************************.9********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.7E-3956168IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.22E-4361201IPR015300DNA-binding pseudobarrel domain
CDDcd100175.08E-2262164No hitNo description
PROSITE profilePS5086313.28164166IPR003340B3 DNA binding domain
PfamPF023626.6E-2264165IPR003340B3 DNA binding domain
SMARTSM010191.4E-2264166IPR003340B3 DNA binding domain
PfamPF065071.6E-29190270IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 680 aa     Download sequence    Send to blast
MQRETTRVMG DTADAATDEV YAQVSLVADN EEAERRMREG EDGAACDGEG EDAVKRPARI  60
PHMFCKTLTA SDTSTHGGFS VPRRAAEDCF PPLDYSLQRP SQELVAKDLH GTEWRFRHIY  120
RGQPRRHLLT TGWSGFINKK KLVSGDAVLF LRGEDGELRL GVRRAAQLKN VSPFPALHNQ  180
ISNTSSLSEV AHAVAVKSIF HIYYNPRLSQ SEFIIPYWKF MRSFSQPFSV GMRFKLRYES  240
EDASERRRTG IIIGSREADP MWHGSKWKCL VVKWDDDVEC RRPNWVSPWE IELSGSVSGS  300
HLSTPHSKRL KSCFPQVNPD IVLPNGSVSS DFAESARFHK VLQGQELLGL KTRDGTVSTA  360
SQATEARNFQ YTDERSCSIN MSNNILGVPR LGVKTPSGNP GFSYHCSGFG ESQRFQEVLQ  420
GQEVFRPYRG GTLSDACIRG SGFRPPDGNH ASGAAFKWLA PQGCDHHGIT TSVLPQASSP  480
SSVLMFPQTS SKMPGLEYIY GCLDRNENSR HFKIGPTQDM ARTDQTLRLW PHLISGKVLD  540
ECTRNEKLHS PVGGAEHESN TNKCLSTNGC KIFGISLTEK AQAGDEVDCG NASYHSRLQS  600
LKPQMPKSLG SSCATGVYMQ KQGLVSYSLV LKDTTSILAI SSLYVLVAST SVFPQAVLPH  660
PGLMTGEMLM MHEGCLSSLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A2e-891330084361Auxin response factor 1
4ldy_B2e-891330084361Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0712910.0AB071291.1 Oryza sativa OsETTIN2 mRNA for Arabidopsis ETTIN-like protein 2, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647511.10.0PREDICTED: auxin response factor 2 isoform X2
SwissprotQ0JKI90.0ARFB_ORYSJ; Auxin response factor 2
TrEMBLA0A0E0C5U90.0A0A0E0C5U9_9ORYZ; Auxin response factor
STRINGBGIOSGA001046-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25373580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-135ARF family protein